Home

About Us

Student Login

Tuition Fees

Donations

Sponsors

Radio Show

Conferences

Links

Contact Us

Go To Applied BioPhysics Foundation

Request Information

Go To "Ask Mom" Radio Show

Presentation at the CDC March 2002, Part 6

 
 

Example of Cellular Derived Gene

Clone 3B516: (5,820 nt). Codes for UL141, UL144, truncated UL145, and 3 divergent copies of gene matching to human MGSA/Gro-alpha. This is a chemokine with potential oncogenic activity (in melanomas and other tumors). Two of the 3 copies of the gene lack a major intron present in genomic DNA. This suggests recombination with RNA rather than DNA.

Alignments of Predicted Amino Acids of Stealth Virus Genes With MGSA/Gro-alpha

Stealth  Gene  A   4938     NPRFLGVTLLLMSLIAY----

                                            CQSTTELRCQCTQTVQGIHPKNIQSVSIKDKGPNCPN 5099 NPR

                                            L V LLL+ L+A TELRCQC  QT+QGIHPKNIQSV++K GP+C  

Human  MGSA  Gene  12    NPRLLRVALLLLLLVAAGRRAAGASVATELRC

                                               QCLTLQGIHPKNIQSVNVKSPGPHCAQ71                                                                 

Stealth  Gene  A    5100  QEVIATLKNGQKVCLNPTAPMVQKILKKTITDN 5198                                                                    

                                            EVIATLKNG+K CLNP +P+V+KI++K + +

Human  MGSA  Gene 72   TEVIATLKNGRKACLNPASPIVKKIIEKMLNSD 104

Stealth  Gene  B    5469       LLVATLLGTLLASTMVFADK---- 

                                              EERCLCPKTIQGIHPKNIQSVELHEPRDMCPNVEVM 5636 

                                              L VA LL L+A+ A E RC C +T+QGIHPKNIQSV + P C EV+

Human  MGSA  Gene  16   LRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPK

                                              NIQSVNVKSPGPHCAQTEVI 75

Stealth  Gene   B   5637    *VCWYCVIIGKLAHEITYNSLYFSYLHSAKLKNGNEVCLNT

                                              EGPMVKKIIEKM 5795   intron   A LKNG + CLN P+VKKIIEKM

 

Human  MGSA  Gene  76 ---------------------------ATLKNGRKACLNPASPIVKKIIEKM 100

Stealth  Gene  C  4583       SPRFLAVALLIVSLIAYSESSQG------IRCECKKGTQKIPENKIV 

                                              VKKMKRPSGPNHP 4744  +PR L VALL++ L+A + G +RC+C + Q

                                              I I +K P GP+

Human  MGSA  Gene  12   NPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHP

                                              KNIQSVNVKSP-GPHCA 70

Stealth    Gene    C    4745   RTEVKDSTKQPGRDPMGRPVS 4807

                                               +TEV +T + GR P S

Human MGSA Gene    71    QTEV-IATLKNGRKACLNPAS 90

Additional cellular genes have been identified in several clones obtained from vira DNA isolated from the stealth virus culture. Many of the genes have highly reiterated/repeat sequences. Some of the sequences match to endogenous reverse transcriptase, suggesting a possible mechanism whereby recombinations invoving cellular RNA can be back translated into viral incorporated cellular DNA.

Conclusions

Atypically structured, non-inflammation inducing cytopathic viruses definetely exist. 

Some of these viruses were derived from simian CMV and have presumably entered the human population from SCMV contaminated batches of live polio vaccines. 

Non-inflammatory cytopathic viruses are grouped under the term "stealth." They can  be regularly cultured from patients with complex multi-system illnesses, including  various cancers. Positive stealth virus cultures were found in approximately 10% of University students donating blood for transfusion. Community outbreaks do occur.

Stealth-adaptation is considered to be a generic process that can involve many types of cytopathic viruses. It presumably occurs through the loss of genes coding for major antigens normally targeted by the cellular immune system. 

Tissue culture provides the best method to screen for stealth-adapted viruses.  Viral cultures can also provide useful insights into pathology, including formation of lipids, and of protease-resistant protein complexes. 

The production of lipids and pigmented materials is viewed as a reparative  process helping to maintain cell viability. There is a marked reduction in the intensity of the CPE if the culture medium is not frequently replaced. 

Bacteria and cell-derived genes are present in the SCMV-derived stealth virus culture. This important finding indicates the potential intermixing of cellular, viral and bacterial genes in the creation of new highly pathogenic organisms. Viteria is used to define viruses with bacterial sequences.  Atypical bacteria can commonly be cultured from stealth virus infected patients.

Stealth viruses are found in cancer patients, many of who have symptoms of an underlying neuropsychiatric illness. The prospect of bacteria transmitting cancer causing viruses is a very serious and urgent public health concern. 

Bacterial genes can help explain partial and inconsistent serological and/or PCR diagnostic findings for mycoplasma, (in CFS, Gulf War Syndrome): Borrelia (in "chronic Lyme disease"), streptococcus (in PANDAS), etc. 

Apparent expansion of chemokines and chemokines-receptor genes provide an adjunctive approach to anti-stealth virus therapy. Many therapeutic agents are available that can lead to cytokine/chemokine suppression.

Ongoing Research Program

• Complete the sequencing of SCMV and SCMV-derived stealth virus

• Test for passage of this virus through bacteria using molecular methods

• Characterize lipids and proteins synthesized in stealth virus cultures

• Survey patient populations for evidence of stealth virus infections and for any

disease-related characteristics of their positive cultures

• Determine if vaccines can activate a stealth virus infection and/or pathology

• Sequence additional stealth virus isolates, especially from cancer patients

• Conduct clinical trials on substances shown to inhibit stealth virus CPE

• Educate clinicians on the multi-system nature of stealth virus infections

Guiding Quotes:

"One can only see what one observes, one observes only the things that are already in the mind."
                                                                                
Alphonse Bertollin, 1853-1914
.

"The more I look, the more I see, and the more I see, the more I look for."
                                                                                
Teihard de Chardin, 1881-1914.

PUBLICATIONS

1. Martin WJ, Zeng LC, Ahmed K, Roy M. Cytomegalovirus-related sequences in an atypical cytopathic virus repeatedly isolated from a patient with the chronic fatigue syndrome. Am. J. Path. 145: 441-452, 1994.

2. Martin WJ. Stealth virus isolated from an autistic child. J. Aut. Dev. Dis. 25:223-224,1995

3. Martin WJ, Ahmed KN, Zeng LC, Olsen J-C, Seward JG, Seehrai JS. African green monkey origin of the atypical cytopathic 'stealth virus' isolated from a patient with chronic fatigue syndrome. Clin. Diag. Virol. 4: 93-103, 1995.

4. Martin WJ, Glass RT. Acute encephalopathy induced in cats with a stealth virus isolated from a patient with chronic fatigue syndrome. Pathobiology 63: 115-118, 1995.

5. Gollard RP, Mayr A, Rice DA, Martin WJ. Herpesvirus-related sequences in salivary gland tumors. J. Exp. Clin. Can. Res. 15: 1-4, 1996.

6. Martin WJ. Genetic instability and fragmentation of a stealth viral genome. Pathobiology 64:9-17, 1996.

7. Martin WJ. Severe stealth virus encephalopathy following chronic fatigue syndrome-like illness: Clinical and histopathological features. Pathobiology 64:1-8, 1996.

8. Martin WJ. Stealth viral encephalopathy: Report of a fatal case complicated by cerebral vasculitis. Pathobiology 64:59-63, 1996.

9. Martin WJ. Simian cytomegalovirus-related stealth virus isolated from the cerebrospinal fluid of a patient with bipolar psychosis and acute encephalopathy. Pathobiology 64:64-66, 1996.

10. Martin WJ, Anderson D: Stealth virus epidemic in the Mohave Valley. Initial report of viral isolation. Pathobiology 65:51-56, 1997.

11. Martin WJ. Cellular sequences in stealth viruses. Patobiology 66:53-58, 1998.

12. Martin WJ. Bacteria related sequences in a simian cytomegalovirus-derived stealth virus culture. Exp Mol Path. 66: 8-14, 1999.

13. Martin WJ. Stealth adaptation of an African green monkey simian cytomegalovirus. Exp Mol Path. 66:3-7, 1999.

14. Martin WJ. Melanoma Growth stimulatory activity (MGSA/GRO-alpha) chemokine genes incorporated into an African green monkey simian cytomegalovirus (SCMV)-derived stealth virus. Exp Mol Path. 66: 15-18,1999.

15. Martin WJ, Anderson D. Stealth Virus Epidemic in the Mohave Valley: Severe vacuolating encephalopathy in a child presenting with a behavioral disorder. Exp Mol Path. 66:19-30 1999.

16. Martin WJ. Chemokine receptor-related sequences in an African green monkey simian cytomegalovirus (SCMV)-derived stealth virus. Exp Mol Path. 69: 10-16, 2000.

17. Martin WJ. Stealth viruses. Explore 10: Number 4, 17-21, 2001.

18. Martin WJ. Chronic fatigue syndrome among clinicians: A potential role of occupational exposure to stealth viruses. Explore

10: Number 5, 7-10, 2001

19. Martin WJ. Chemokines and stealth viruses. A blueprint for therapy in infected humans and animals. Explore 11, Number 1, 7-11, 2002.


 

EMAIL

Copyright 2006 Progressive University